The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Probable phosphoribosylglycinamide formyl transferase from Pyrococcus horikoshii OT3 complexed with ADP. To be Published
    Site RSGI
    PDB Id 2dwc Target Id pho001000318.2
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13812, Molecular Weight 48700.45 Da.
    Residues 433 Isoelectric Point 6.31
    Sequence mvvmiklrdelgtattdsaqkilllgsgelgkeiaieaqrlgvevvavdryanapamqvahrsyvgnmm dkdflwsvverekpdaiipeieainldalfefekdgyfvvpnaratwiamhrerlretlvkeakvptsr ymyattldelyeacekigypchtkaimsssgkgsyfvkgpedipkaweeaktkargsaekiiveehidf dvevtelavrhfdengeivttfpkpvghyqidgdyhaswqpaeisekaerevyriakritdvlgglgif gvemfvkgdkvwanevsprphdtgmvtlashppgfsefalhlravlglpipgewvdgyrlfpmlipaat hvikakvsgysprfrglvkalsvpnatvrlfgkpeayvgrrlgialawdkdvevakrkaemvahmielr trssdwhdqnyekrkhllr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.70 Rfree 0.204
    Matthews' coefficent 3.41 Rfactor 0.181
    Waters 519 Solvent Content 63.88

    Ligand Information


    Google Scholar output for 2dwc

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch