The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Aurora-A kinase complexed with AMPPNP. To be Published
    Site RSGI
    PDB Id 2dwb Target Id ar_001000141.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12126, Molecular Weight 32635.71 Da.
    Residues 282 Isoelectric Point 9.11
    Sequence eskkrqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrreveiqshlrh pnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanalsychskrvihrdikp enlllgsagelkiadfgwsvhapssrrttlcgtldylppemiegrmhdekvdlwslgvlcyeflvgkpp feantyqetykrisrveftfpdfvtegardlisrllkhnpsqrpmlrevlehpwitansskpsncqnke saskqs
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.50 Rfree 0.275
    Matthews' coefficent 2.51 Rfactor 0.227
    Waters 30 Solvent Content 51.03

    Ligand Information


    Google Scholar output for 2dwb

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch