.
The Open Protein Structure Annotation Network
PDB Keyword
.

2dw4

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of histone demethylase LSD1 and tranylcypromine at 2.25A. Biochem.Biophys.Res.Commun. 366 15-22 2008
    Site RSGI
    PDB Id 2dw4 Target Id hsk002000585.4
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12597, Molecular Weight 76947.31 Da.
    Residues 700 Isoelectric Point 6.03
    Sequence mlsgkkaaaaaaaaaaaatgteagpgtaggsengsevaaqpaglsgpaevgpgavgertprkkeppras ppgglaeppgsagpqagptvvpgsatpmetgiaetpegrrtsrrkrakveyremdeslanlsedeyyse eernakaekekklpppppqappeeenesepeepsgvegaafqsrlphdrmtsqeaacfpdiisgpqqtq kvflfirnrtlqlwldnpkiqltfeatlqqleapynsdtvlvhrvhsylerhglinfgiykrikplptk ktgkviiigsgvsglaaarqlqsfgmdvtlleardrvggrvatfrkgnyvadlgamvvtglggnpmavv skqvnmelakikqkcplyeangqavpkekdemveqefnrlleatsylshqldfnvlnnkpvslgqalev viqlqekhvkdeqiehwkkivktqeelkellnkmvnlkekikelhqqykeasevkpprditaeflvksk hrdltalckeydelaetqgkleeklqeleanppsdvylssrdrqildwhfanlefanatplstlslkhw dqdddfeftgshltvrngyscvpvalaegldiklntavrqvrytasgceviavntrstsqtfiykcdav lctlplgvlkqqppavqfvpplpewktsavqrmgfgnlnkvvlcfdrvfwdpsvnlfghvgsttasrge lflfwnlyka
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.30 Rfree 0.226
    Matthews' coefficent 3.63 Rfactor 0.192
    Waters 294 Solvent Content 66.10

    Ligand Information
    Ligands FAD (FLAVIN-ADENINE) x 1
    Metals

    Jmol

     
    Google Scholar output for 2dw4

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch