The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural Basis for Acetylated Histone H4 Recognition by the Human BRD2 Bromodomain. J.Biol.Chem. 285 7610-7618 2010
    Site RSGI
    PDB Id 2dvr Target Id ar_001000221.2
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12128, Molecular Weight 13623.90 Da.
    Residues 122 Isoelectric Point 7.08
    Sequence krrlennyywaasecmqdfntmftncyiynkptddivlmaqtlekiflqkvasmpqeeqelvvtipkns hkkgaklaalqgsvtsahqvpavssvshtalytpppeipttvfniphpsviss
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.30 Rfree 0.243
    Matthews' coefficent 2.30 Rfactor 0.18
    Waters 250 Solvent Content 47.00

    Ligand Information


    Google Scholar output for 2dvr

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch