The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of TT0160 from Thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 2dvl Target Id ttk003000160.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14254, Molecular Weight 40872.67 Da.
    Residues 372 Isoelectric Point 7.79
    Sequence mtltqeqrlvldavrrvarevlyplapeydrkaeypwpqlkalaelgllgmttpeewggvgldsvtwal aleelaaadpsvavivsvtsglpqymllrfgseaqkrrylvplargewigafcltepqagsdakslrae arrvkggfvlngvkswitsaghahlyvvmartekgisaflvekgtpglsfgrpeekmglhaahtaevrl eevfvpeenllgeegrglayalagldsgrvgvaaqavgiargafeiakayaeereqfgkklkehqaiaf kiadmhvkiaaaralvleaarkkdrgerftleasaaklfasaaavevtreavqvlggygyhrdyrvery yrdakvteiyegtseiqrlviarelyr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.50 Rfree 0.23
    Matthews' coefficent 3.09 Rfactor 0.193
    Waters 288 Solvent Content 60.25

    Ligand Information
    Ligands FAD (FLAVIN-ADENINE) x 2


    Google Scholar output for 2dvl

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch