.
The Open Protein Structure Annotation Network
PDB Keyword
.

2dvk

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Hypothetical protein from Aeropyrum pernix. To be Published
    Site RSGI
    PDB Id 2dvk Target Id ape001000816.1
    Molecular Characteristics
    Source Aeropyrum pernix
    Alias Ids TPS12100, Molecular Weight 20993.11 Da.
    Residues 188 Isoelectric Point 6.23
    Sequence mgsieevlleerligyldpgaekvlarinrpskivstssctgritliegeahwlrngarvaykthhpis rsevervlrrgftnlwlkvtgpilhlrvegwqcakslleaarrngfkhsgvisiaedsrlvieimssqs msvplvmegarivgddaldmliekantilvesrigldtfsreveelvecf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.249
    Matthews' coefficent 2.14 Rfactor 0.234
    Waters 200 Solvent Content 42.42

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2dvk

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch