The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of BRCT domain of DNA polymerase mu. To be Published
    Site RSGI
    PDB Id 2dun Target Id hss001002753.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13306, Molecular Weight 13007.24 Da.
    Residues 120 Isoelectric Point 8.47
    Sequence strfpgvaiylveprmgrsrrafltglarskgfrvldacsseathvvmeetsaeeavswqerrmaaapp gctppalldiswlteslgagqpvpvecrhrlevagprkgplspawmpayac
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 2dun

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch