.
The Open Protein Structure Annotation Network
PDB Keyword
.

2duk

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of MS0616. To be Published
    Site RSGI
    PDB Id 2duk Target Id mmi002019512.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13410, Molecular Weight 15944.30 Da.
    Residues 138 Isoelectric Point 5.50
    Sequence trtydregfkkraaclcfrseqedevllvsssrypdqwivpgggmepeeepggaavrevyeeagvkgkl grllgifenqdrkhrtyvyvltvteiledwedsvnigrkrewfkvedaikvlqchkpvhaeyleklklg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.62 Rfree 0.28747
    Matthews' coefficent 2.48 Rfactor 0.24676
    Waters 61 Solvent Content 50.32

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2duk

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch