The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of human mitochondrial single-stranded DNA-binding protein(hmtSSB). To be Published
    Site RSGI
    PDB Id 2dud Target Id hso002001116.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12955, Molecular Weight 15331.53 Da.
    Residues 133 Isoelectric Point 8.16
    Sequence hesetttslvlerslnrvhllgrvgqdpvlrqvegknpvtifslatnemwrsgdsevyqlgdvsqkttw hrisvfrpglrdvayqyvkkgsriylegkidygeymdknnvrrqattiiadniiflsdqtkeke
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.70 Rfree 0.287
    Matthews' coefficent 2.42 Rfactor 0.259
    Waters Solvent Content 49.24

    Ligand Information


    Google Scholar output for 2dud

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch