.
The Open Protein Structure Annotation Network
PDB Keyword
.

2dt7

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structures of the SURP domains and the subunit-assembly mechanism within the splicing factor SF3a complex in 17S U2 snRNP. Structure 14 1677-1689 2006
    Site RSGI
    PDB Id 2dt7 Target Id hss001001930.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13284, Molecular Weight 4387.79 Da.
    Residues 37 Isoelectric Point 7.01
    Sequence elnaisgpnefaefynrlkqikefhrkhpneicvpms
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2dt7

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch