The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of diphthine synthase from Pyrococcus horikoshii OT3. To be Published
    Site RSGI
    PDB Id 2dsh Target Id pho001000725.7
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13923, Molecular Weight 29609.78 Da.
    Residues 265 Isoelectric Point 5.61
    Sequence mvlyfiglglyderditvkgleiakycdyvfaefytslmagttlgriqkligkeirvlsredvelnfen ivlplakendvafltpgdplvatthaelrirakragvesyvihapsiysavgitglhiykfgksatvay pegnwfptsyydvikenaerglhtllfldikaekrmymtaneamelllkvedmkkggvftddtlvvvla ragslnptiragyvkdliredfgdpphilivpgklhiveaeylveiagapreilrvnv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.218
    Matthews' coefficent 3.14 Rfactor 0.194
    Waters 510 Solvent Content 60.86

    Ligand Information


    Google Scholar output for 2dsh

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch