The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the PH0078 protein from Pyrococcus horikoshii OT3. To be Published
    Site RSGI
    PDB Id 2drh Target Id pho001000078.1
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13760, Molecular Weight 38992.95 Da.
    Residues 361 Isoelectric Point 8.87
    Sequence mkaqelgikigvfkpgkrnkitdvkgvkvghvtlikgkgklipgkgpvrtgvtailphegniykekvla gafvmngyskpvgliqlwelgtietpiiltntlsigtaveglldyileenedigvttgsvnplvlecnd sylndirgrhvkrehvveaikradedfeegavgagtgmsafefkggigsasriveiegkkytvgalvls nfgrredltiagvpvglelknwpgrggegkgsiimiiatdapltgrqlnrvakraivglartggyayng sgdiavafstanrikhyekevieikalpdsvisplfkataeaveeaiinslleartmdgrdnhvryalp keellrimrrygrlee
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.10 Rfree 0.249
    Matthews' coefficent 2.13 Rfactor 0.209
    Waters 685 Solvent Content 42.35

    Ligand Information
    Metals CL (CHLORIDE) x 4


    Google Scholar output for 2drh

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch