The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the PH1308 protein from Pyrococcus horikoshii OT3. To be Published
    Site RSGI
    PDB Id 2dr1 Target Id pho001001308.1
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13986, Molecular Weight 43485.37 Da.
    Residues 386 Isoelectric Point 6.13
    Sequence meimefeeafkevyemvkpkyklftagpvacfpevleimkvqmfshrskeyrkvhmdtverlrefleve kgevllvpssgtgimeasirngvskggkvlvtiigafgkrykevvesngrkavvleyepgkavkpedld dalrknpdveavtitynetstgvlnplpelakvakehdklvfvdavsamggadikfdkwgldvvfsssq kafgvppglaigafserfleiaekmpergwyfdiplyvkylkekestpstppmpqvfginvalriiekm ggkekwlemyekrakmvregvreigldilaepghesptitavltppgikgdevyeamrkrgfelakgyg svkektfrighmgymkfediqemldnlrevinelkkqkgin
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.90 Rfree 0.202
    Matthews' coefficent 2.57 Rfactor 0.18
    Waters 554 Solvent Content 52.19

    Ligand Information
    Ligands PLP (PYRIDOXAL-5'-PHOSPHATE) x 2
    Metals CL (CHLORIDE) x 2;NA (SODIUM) x 2


    Google Scholar output for 2dr1

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch