.
The Open Protein Structure Annotation Network
PDB Keyword
.

2dqb

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of dNTP-inducible dNTP triphosphohydrolase: insight into broad specificity for dNTPs and triphosphohydrolase-type hydrolysis. ACTA CRYSTALLOGR.,SECT.D 63 230-239 2007
    Site RSGI
    PDB Id 2dqb Target Id ttk003001383.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14714, Molecular Weight 42608.05 Da.
    Residues 376 Isoelectric Point 6.00
    Sequence mrfsrealleleasrlapyaqkardtrgrahpepeslyrtpyqkdrdrilhttafrrleyktqvlpgwa gdyyrtrlthtlevaqvsrsiaralglnedlteaialshdlghppfghtgehvlnalmqdhggfehnaq alrilthlevrypgfrglnltyevlegiatheaayspgfkplyegqgtleaqvvdlsdaiayaahdldd glragllhpeelkevellqalaleegldllrlpeldrrvlvrqllgyfitaaieathrrveeagvqsae avrrhpsrlaalgeeaekalkalkaflmerfyrhpevlrerrkaeavleglfaaytrypellprevqak ipeegleravcdyiagmtdrfaleayrrlsp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.20 Rfree 0.286
    Matthews' coefficent 2.26 Rfactor 0.223
    Waters 305 Solvent Content 45.49

    Ligand Information
    Ligands
    Metals MG (MAGNESIUM) x 6

    Jmol

     
    Google Scholar output for 2dqb

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch