.
The Open Protein Structure Annotation Network
PDB Keyword
.

2dq3

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of aq_298. To be Published
    Site RSGI
    PDB Id 2dq3 Target Id aae001000298.1
    Molecular Characteristics
    Source Aquifex aeolicus
    Alias Ids TPS12033, Molecular Weight 49430.09 Da.
    Residues 425 Isoelectric Point 6.14
    Sequence midinlirekpdyvkerlatrdkelvslvdkvleldkrrreiikrlealrsernklskeigklkregkd tteiqnrvkelkeeidrleeelrkveeelkntllwipnlphpsvpvgedekdnvevrrwgeprkfdfep kphweigerlgildfkrgaklsgsrftviagwgarleralinfmldlhtkkgykeicpphlvkpeilig tgqlpkfeedlykcerdnlyliptaevpltnlyreeilkeenlpiyltaytpcyrreagaygkdirgii rqhqfdkvelvkivhpdtsydeleklvkdaeevlqllglpyrvvelctgdlgfsaaktydievwfpsqn kyreisscsncedfqarrmntrfkdsktgknrfvhtlngsglavgrtlaailenyqqedgsvvvpevlr dyvgtdvirpe
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 3.00 Rfree 0.297
    Matthews' coefficent 2.88 Rfactor 0.219
    Waters 81 Solvent Content 57.25

    Ligand Information
    Ligands SSA (5'-O-(N-(L-SERYL)-SULFAMOYL)ADENOSINE) x 2
    Metals

    Jmol

     
    Google Scholar output for 2dq3

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch