.
The Open Protein Structure Annotation Network
PDB Keyword
.

2dpo

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the Rabbit L-Gulonate 3-Dehydrogenase. To be Published
    Site RSGI
    PDB Id 2dpo Target Id my_001000051.1
    Molecular Characteristics
    Source Oryctolagus cuniculus
    Alias Ids TPS13733, Molecular Weight 35270.89 Da.
    Residues 320 Isoelectric Point 6.67
    Sequence maspaagdvlivgsglvgrswamlfasggfrvklydieprqitgalenirkemkslqqsgslkgslsae eqlslissctnlaeavegvvhiqecvpenldlkrkifaqldsivddrvvlssssscllpsklftglahv kqcivahpvnppyyiplvelvphpetspatvdrthalmrkigqspvrvlkeidgfvlnrlqyaiiseaw rlveegivspsdldlvmsdglgmryafigpletmhlnaegmlsysdrysegmkrvlksfgsipefsgat vekvnqamckkgpadpehlaarrewrdeclkrelaklkrqmqpq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.206
    Matthews' coefficent 2.25 Rfactor 0.182
    Waters 419 Solvent Content 45.40

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2dpo

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch