.
The Open Protein Structure Annotation Network
PDB Keyword
.

2dpn

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Nucleant-mediated protein crystallization with the application of microporous synthetic zeolites. Acta Crystallogr.,Sect.D 64 686-695 2008
    Site RSGI
    PDB Id 2dpn Target Id ttk003000486.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14378, Molecular Weight 53343.25 Da.
    Residues 495 Isoelectric Point 5.80
    Sequence mafllaldqgttssrailftlegrpvavakrefrqlypkpgwvehdpleiwettlwaarevlrragaea gevlalgitnqrettllwdrktgkplhnaivwqdrrttplcealrakgleplfrertgllfdpyfsgtk lvwllenvpglkaraegggvafgtvdtwliwnltggkvhatdptnasrtllfnlhtlawdpellealgi paallpevrpsdgdfgetlpellgapvpirgvlgdqqaalfgqaalgggegkctygtgaflllntgkrp vlsekgllatvawslggratyalegslfvagaavgwlkevgliresaevealaasvedtgdvyfvpaft glgapywdpyargtllgltrgtsrahlaraalegvafqvrdvvlameeeagvrlkvlkadggmaqnrlf lkiqadllgvpvavpevtettalgaalmagvgagalspedvagrfreaerflptmpegrrealyrrwre averakgwareg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.80 Rfree 0.266
    Matthews' coefficent 2.63 Rfactor 0.213
    Waters 382 Solvent Content 53.31

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2dpn

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch