The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Conserved Hypothetical Protein TTHA0113 from Thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 2dp9 Target Id ttk003001768.2
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14791, Molecular Weight 14435.02 Da.
    Residues 124 Isoelectric Point 9.34
    Sequence mdymerpklglivrepyaslivdgrkvweirrrktrhrgplgivsggrligqadlvgvegpfsveella hqekhlaeeaflrayakdeplyawvlenafryekplhvprrpgrvmfvdlsevrw
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.25
    Matthews' coefficent 2.10 Rfactor 0.215
    Waters 76 Solvent Content 41.47

    Ligand Information


    Google Scholar output for 2dp9

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch