The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title probable N-succinyldiaminopimelate aminotransferase (TTHA0342) from Thermus thermophilus HB8. To be published
    Site RSGI
    PDB Id 2dou Target Id ttk003000024.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14166, Molecular Weight 41226.31 Da.
    Residues 376 Isoelectric Point 5.59
    Sequence msrvpepsvflvvdeakrkarergvglidlsigstdlpppeaplkalaealndpttygyclksctlpfl eeaarwyegrygvgldprrealaligsqeglahlllaltepedllllpevaypsyfgaarvaslrtfli plredgladlkavpegvwreakvlllnypnnptgavadwgyfeealglarkhglwlihdnpyvdqvyeg eapsplalpgakervvelfslsksynlagfrlgfalgseealarlervkgvidfnqyagvlrmgvealk tpkevvrgyarvyreralgmaealkgvlsllppratmylwgrlpegvddlefglrlvergvalapgrgf gpggkgfvrialvrpleelleaakrireald
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.30 Rfree 0.254
    Matthews' coefficent 3.85 Rfactor 0.222
    Waters 204 Solvent Content 68.02

    Ligand Information
    Ligands SO4 (SULFATE) x 4;EPE (4-(2-HYDROXYETHYL)-1-PIPERAZINE) x 1


    Google Scholar output for 2dou

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch