The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the helical domain in human Eleven-nineteen lysine-rich leukemia protein ELL. To be Published
    Site RSGI
    PDB Id 2doa Target Id hso002002362.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13009, Molecular Weight 10483.62 Da.
    Residues 91 Isoelectric Point 9.26
    Sequence vsqrpfrdrvlhllalrpyrkaelllrlqkdgltqadkdaldgllqqvanmsakdgtctlqdcmykdvq kdwpgysegdqqllkrvlvrkl
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 2doa

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch