.
The Open Protein Structure Annotation Network
PDB Keyword
.

2do9

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the Pyrin/PAAD-DAPIN domain in mouse NALP10 (NACHT, leucine rich repeat and PYD containing 10). To be Published
    Site RSGI
    PDB Id 2do9 Target Id mmt008000594.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13627, Molecular Weight 11754.85 Da.
    Residues 102 Isoelectric Point 5.26
    Sequence malaranspqeallwalndleensfktlkfhlrdvtqfhlargeleslsqvdlasklismygaqeavrv vsrsllamnlmelvdylnqvclndyreiyrehv
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2do9

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch