.
The Open Protein Structure Annotation Network
PDB Keyword
.

2do5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the SAP domain of human splicing factor 3B subunit 2. To be Published
    Site RSGI
    PDB Id 2do5 Target Id hsk003001690.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12855, Molecular Weight 5039.43 Da.
    Residues 45 Isoelectric Point 6.34
    Sequence ygawaaqelqaklaeigapiqgnreelverlqsytrqtgivlnrp
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2do5

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch