.
The Open Protein Structure Annotation Network
PDB Keyword
.

2dnv

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution Structure of RSGI RUH-055, a Chromo Domain from Mus musculus cDNA. To be published
    Site RSGI
    PDB Id 2dnv Target Id mmi002020274.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13412, Molecular Weight 6183.86 Da.
    Residues 51 Isoelectric Point 9.60
    Sequence ervfaaeallkrrirkgrmeylvkwkgwsqkystwepeenildarllaafe
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2dnv

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch