The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of RNA binding domain in SRp46 splicing factor. To be Published
    Site RSGI
    PDB Id 2dnm Target Id hso002000005.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12900, Molecular Weight 10379.10 Da.
    Residues 90 Isoelectric Point 8.68
    Sequence pdvdgmitlkvdnltyrtspdslrrvfekygrvgdvyiprephtkaprgfafvrfhdrrdaqdaeaamd gaeldgrelrvqvarygrrdl
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 2dnm

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch