.
The Open Protein Structure Annotation Network
PDB Keyword
.

2dn8

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution Structure of RSGI RUH-053, an Apo-Biotin Carboxy Carrier Protein from Human Transcarboxylase. To be published
    Site RSGI
    PDB Id 2dn8 Target Id hsk003000770.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12829, Molecular Weight 9564.49 Da.
    Residues 87 Isoelectric Point 5.63
    Sequence tcvfekendptvlrspsagkltqytvedgghveagssyaemevmkmimtlnvqergrvkyikrpgavle agcvvarlelddpskvhp
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2dn8

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch