.
The Open Protein Structure Annotation Network
PDB Keyword
.

2dmv

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the second ww domain of Itchy homolog E3 ubiquitin protein ligase (Itch). To be Published
    Site RSGI
    PDB Id 2dmv Target Id hso002000508.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12916, Molecular Weight 3720.97 Da.
    Residues 30 Isoelectric Point 6.93
    Sequence lppgweqrvdqhgrvyyvdhvekrttwdrp
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2dmv

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch