The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The solution structure of the homeobox domain of human homeobox protein TGIF2LX. To be Published
    Site RSGI
    PDB Id 2dmn Target Id hsi002022865.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12553, Molecular Weight 8542.52 Da.
    Residues 70 Isoelectric Point 10.33
    Sequence kkrkgnlpaesvkilrdwmykhrfkaypseeekqmlsektnlsllqisnwfinarrrilpdmlqqrrndp
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 2dmn

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch