.
The Open Protein Structure Annotation Network
PDB Keyword
.

2dmj

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the first zf-PARP domain of human Poly(ADP-ribose)polymerase-1. To be Published
    Site RSGI
    PDB Id 2dmj Target Id hss001003531.5
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13333, Molecular Weight 10653.60 Da.
    Residues 93 Isoelectric Point 8.47
    Sequence maessdklyrveyaksgrasckkcsesipkdslrmaimvqspmfdgkvphwyhfscfwkvghsirhpdv evdgfselrwddqqkvkktaeagg
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 1

    Jmol

     
    Google Scholar output for 2dmj

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch