.
The Open Protein Structure Annotation Network
PDB Keyword
.

2dmi

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the first and the second zf-C2H2 like domains of human Teashirt homolog 3. To be Published
    Site RSGI
    PDB Id 2dmi Target Id hsk002001446.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12654, Molecular Weight 11898.93 Da.
    Residues 102 Isoelectric Point 8.68
    Sequence klygsiftgaskfrckdcsaaydtlveltvhmnetghyrddnhetdnnnpkrwskprkrsllemegked aqkvlkcmycghsfeslqdlsvhmiktkhyqkv
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 2

    Jmol

     
    Google Scholar output for 2dmi

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch