.
The Open Protein Structure Annotation Network
PDB Keyword
.

2dma

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of PH1978 from Pyrococcus horikoshii OT3 (form II). To be Published
    Site RSGI
    PDB Id 2dma Target Id pho001001978.2
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS14026, Molecular Weight 22887.01 Da.
    Residues 198 Isoelectric Point 5.29
    Sequence mngaeliiqeinkeaerkieyilnearqqaekikeearrnaeakaewiirraktqaelekqriianarl evrrkrlaiqeeiissvleevkrrletmsedeyfesvkallkeaikelnekkvrvmsnektlgliasri eeikselgdvsielgetvdtmggvivetedgriridntfearmerfegeirstiakvlfg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.05 Rfree 0.261
    Matthews' coefficent 1.60 Rfactor 0.224
    Waters 77 Solvent Content 28.00

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2dma

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch