The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of anti-configuration of indomethacin and leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase complex reveals the structural basis of broad spectrum indomethacin efficacy. J.Biochem.(Tokyo) 140 457-466 2006
    Site RSGI
    PDB Id 2dm6 Target Id my_001000011.4
    Molecular Characteristics
    Source Cavia porcellus
    Alias Ids TPS13674, Molecular Weight 36188.15 Da.
    Residues 333 Isoelectric Point 8.47
    Sequence spefmvkakswtlkkhfqgkptqsdfelktvelpplkngevllealflsvdpymriaskrlkegavmmg qqvarvvesknsafpagsivlaqsgwtthfisdgkgleklltewpdklplslalgtigmpgltayfgll evcgvkggetvlvsaaagavgsvvgqiaklkgckvvgaagsdekiaylkqigfdaafnyktvnsleeal kkaspdgydcyfdnvggeflntvlsqmkdfgkiaicgaisvynrmdqlppgpspesiiykqlriegfiv yrwqgdvrekalrdlmkwvlegkiqyhehvtkgfenmpaafiemlnganlgkavvta
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.224
    Matthews' coefficent 2.38 Rfactor 0.181
    Waters 600 Solvent Content 48.22

    Ligand Information


    Google Scholar output for 2dm6

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch