.
The Open Protein Structure Annotation Network
PDB Keyword
.

2dly

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the SH2 domain of murine Fyn-related kinase. To be Published
    Site RSGI
    PDB Id 2dly Target Id mmt008000775.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13634, Molecular Weight 12444.46 Da.
    Residues 108 Isoelectric Point 6.84
    Sequence aedrslqaepwffgaikradaekqllysenqtgafliresesqkgdfslsvldegvvkhyrirrldegg ffltrrkvfstlnefvnyytttsdglcvklekpclkiqv
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2dly

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch