The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the UAS domain of human UBX domain-containing protein 7. to be published
    Site RSGI
    PDB Id 2dlx Target Id hsk002000776.3
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12610, Molecular Weight 16326.70 Da.
    Residues 140 Isoelectric Point 5.25
    Sequence idkklttladlfrppidlmhkgsfetakecgqmqnkwlminiqnvqdfacqclnrdvwsneavkniire hfifwqvyhdseegqryiqfyklgdfpyvsildprtgqklvewhqldvssfldqvtgflgehgqldgls ss
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 2dlx

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch