.
The Open Protein Structure Annotation Network
PDB Keyword
.

2dls

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the PDZ domain of human Rho guanine nucleotide exchange factor 11. To be Published
    Site RSGI
    PDB Id 2dls Target Id hsk002000370.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12587, Molecular Weight 8437.45 Da.
    Residues 80 Isoelectric Point 9.90
    Sequence vqrcviiqkdqhgfgftvsgdrivlvqsvrpggaamkagvkegdriikvngtmvtnsshlevvkliksg ayvaltllgss
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2dls

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch