The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the first SH3 domain of Stac protein. To be published
    Site RSGI
    PDB Id 2dl4 Target Id hsi002013291.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12494, Molecular Weight 6561.07 Da.
    Residues 55 Isoelectric Point 4.46
    Sequence ntyvalykfvpqenedlemrpgdiitlledsnedwwkgkiqdrigffpanfvqrl
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 2dl4

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch