The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the first SH3 domain of human sorbin and Sh3 domain-containing protein 1. To be published
    Site RSGI
    PDB Id 2dl3 Target Id hso002001263.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12970, Molecular Weight 6591.27 Da.
    Residues 55 Isoelectric Point 9.11
    Sequence rparakfdfkaqtlkelplqkgdivyiykqidqnwyegehhgrvgifprtyiell
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 2dl3

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch