.
The Open Protein Structure Annotation Network
PDB Keyword
.

2dl0

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the SAM-domain of the SAM and SH3 domain containing protein 1. To be Published
    Site RSGI
    PDB Id 2dl0 Target Id hsk002100772.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12732, Molecular Weight 8881.81 Da.
    Residues 84 Isoelectric Point 7.95
    Sequence gglteicrkpvspgcissvsdwlisiglpmyagtlstagfstlsqvpslshtclqeagiteerhirkll saarlfklppgpeam
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2dl0

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch