.
The Open Protein Structure Annotation Network
PDB Keyword
.

2dkz

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the SAM_PNT-domain of the hypothetical protein LOC64762. To be Published
    Site RSGI
    PDB Id 2dkz Target Id hss001001067.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13233, Molecular Weight 8009.84 Da.
    Residues 71 Isoelectric Point 4.58
    Sequence pwqppadlsglsieevskslrfiglsedvisffvtekidgnllvqlteeilsedfklsklqvkkimqfi ng
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2dkz

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch