.
The Open Protein Structure Annotation Network
PDB Keyword
.

2dkx

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the SAM_PNT-domain of ETS transcription factor PDEF (Prostate ets). To be Published
    Site RSGI
    PDB Id 2dkx Target Id hsi002012673.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12482, Molecular Weight 9491.41 Da.
    Residues 83 Isoelectric Point 5.85
    Sequence lkdietackllnitadpmdwspsnvqkwllwtehqyrlppmgkafqelagkelcamseeqfrqrsplgg dvlhahldiwksaa
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2dkx

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch