The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the PTB domain of KIAA1075 protein from human. To be Published
    Site RSGI
    PDB Id 2dkq Target Id hsk002101050.2
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12753, Molecular Weight 15963.28 Da.
    Residues 147 Isoelectric Point 9.41
    Sequence mstaadllrqgaacsvlyltsvetesltgpqavarassaalscsprptpavvhfkvsaqgitltdnqrk lffrrhypvnsitfsstdpqdrrwtnpdgttskifgfvakkpgspwenvchlfaeldpdqpagaivtfi tkvllgqrk
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 2dkq

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch