.
The Open Protein Structure Annotation Network
PDB Keyword
.

2dkf

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of TTHA0252 from Thermus thermophilus HB8, a RNA degradation protein of the metallo-beta-lactamase superfamily. J.Biochem.(Tokyo) 140 535-542 2006
    Site RSGI
    PDB Id 2dkf Target Id ttk003001672.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14768, Molecular Weight 47052.67 Da.
    Residues 431 Isoelectric Point 6.15
    Sequence mrivpfgaarevtgsahlllaggrrvlldcgmfqgkeearnhapfgfdpkevdavllthahldhvgrlp klfregyrgpvyatratvllmeivledalkvmdepffgpedveealghlrpleygewlrlgalslafgq aghlpgsafvvaqgegrtlvysgdlgnrekdvlpdpslppladlvlaegtygdrphrpyretvreflei lektlsqggkvliptfaveraqeilyvlythghrlprapiyldspmagrvlslyprlvryfseevqahf lqgknpfrpaglevvehteaskalnrapgpmvvlagsgmlaggrilhhlkhglsdprnalvfvgyqpqg glgaeiiarppavrilgeevplrasvhtlggfsghagqdelldwlqgeprvvlvhgeeekllalgklla lrgqevslarfgegvpv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.80 Rfree 0.2848
    Matthews' coefficent 3.20 Rfactor 0.2417
    Waters 92 Solvent Content 61.52

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 8

    Jmol

     
    Google Scholar output for 2dkf

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch