The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of WWE domain in poly (ADP-ribose) polymerase family, member 11 (PARP 11). To be Published
    Site RSGI
    PDB Id 2dk6 Target Id hsi002013091.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12488, Molecular Weight 10279.97 Da.
    Residues 89 Isoelectric Point 5.23
    Sequence nevddmdtsdtqwgwfylaecgkwhmfqpdtnsqcsvssedieksfktnpcgsisfttskfsykidfae mkqmnlttgkqrlikrapfs
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 2dk6

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch