The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of RRM domain in heterogeneous nuclear ribonucleoprotein R (hnRNP R). To be Published
    Site RSGI
    PDB Id 2dk2 Target Id hsi002004045.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12362, Molecular Weight 9610.67 Da.
    Residues 84 Isoelectric Point 5.50
    Sequence dpevmakvkvlfvrnlattvteeileksfsefgklervkklkdyafvhfedrgaavkamdemngkeieg eeieivlakppdkkr
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 2dk2

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch