The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structures of the PDZ domain of human unnamed protein product. To be Published
    Site RSGI
    PDB Id 2djt Target Id hss001001061.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13231, Molecular Weight 9531.37 Da.
    Residues 91 Isoelectric Point 9.30
    Sequence qasghfsvelvrgyagfgltlgggrdvagdtplavrgllkdgpaqrcgrlevgdlvlhingestqglth aqaveriraggpqlhlvirrpl
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 2djt

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch