.
The Open Protein Structure Annotation Network
PDB Keyword
.

2djp

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The solution structure of the LysM domain of human hypothetical protein SB145. To be Published
    Site RSGI
    PDB Id 2djp Target Id hsg002000086.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12328, Molecular Weight 7447.24 Da.
    Residues 64 Isoelectric Point 8.94
    Sequence cspvrerrlehqlepgdtlaglalkygvtmeqikranrlytndsiflkktlyipilteprdlfn
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2djp

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch