The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the RING domain of the human Polycomb group RING finger protein 6. To be Published
    Site RSGI
    PDB Id 2djb Target Id hsi002006921.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12415, Molecular Weight 6796.62 Da.
    Residues 59 Isoelectric Point 8.24
    Sequence nlseltpyilcsickgylidattiteclhtfckscivrhfyysnrcpkcnivvhqtqpl
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Metals ZN (ZINC) x 2


    Google Scholar output for 2djb

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch