.
The Open Protein Structure Annotation Network
PDB Keyword
.

2dj6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of 6-pyruvoyl tetrahydrobiopterin synthase from Pyrococcus horikoshii OT3. To be Published
    Site RSGI
    PDB Id 2dj6 Target Id pho001000634.1
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13843, Molecular Weight 13510.82 Da.
    Residues 115 Isoelectric Point 5.52
    Sequence mksriivrtsfdaahavkvgdhwedvhghtfflevaiegeikngyvmdflelrkiveeitkeldhrnln nifenpttenialwigerirdklppyvklkrvvlwegkdngvelew
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.10 Rfree 0.2305
    Matthews' coefficent 2.23 Rfactor 0.2005
    Waters 219 Solvent Content 44.86

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2dj6

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch