The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The solution structure of the first thioredoxin domain of mouse Protein disulfide-isomerase A4. To be Published
    Site RSGI
    PDB Id 2dj1 Target Id mmt008000334.2
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13617, Molecular Weight 14123.00 Da.
    Residues 127 Isoelectric Point 4.38
    Sequence dddlevkeengvwvlndgnfdnfvadkdtvllefyapwcghckqfapeyekiastlkdndppiavakid atsasmlaskfdvsgyptikilkkgqavdydgsrtqeeivakvrevsqpdwtpppevt
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 2dj1

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch