The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The solution structure of the third thioredoxin domain of human Thioredoxin domain-containing protein 5. To be Published
    Site RSGI
    PDB Id 2diz Target Id hsi002004474.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12368, Molecular Weight 12251.31 Da.
    Residues 110 Isoelectric Point 6.25
    Sequence tvlaltennfddtiaegitfikfyapwcghcktlaptweelskkefpglagvkiaevdctaernicsky svrgyptlllfrggkkvsehsggrdldslhrfvlsqakdel
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 2diz

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch