.
The Open Protein Structure Annotation Network
PDB Keyword
.

2diw

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the RPR domain of Putative RNA-binding protein 16. To be Published
    Site RSGI
    PDB Id 2diw Target Id hsk002101090.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12754, Molecular Weight 16059.86 Da.
    Residues 139 Isoelectric Point 9.59
    Sequence dnmeavktfnselyslndykppiskakmtqitkaaikaikfykhvvqsvekfiqkckpeykvpglyvid sivrqsrhqfgqekdvfaprfsnniistfqnlyrcpgddkskivrvlnlwqknnvfkseiiqplldmaag
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2diw

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch